PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G071500.2
Common NameB456_003G071500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 172aa    MW: 19698.5 Da    PI: 10.9237
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G071500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.4e-1497141347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT eE++l++ + ++ G+g+W++I+ ++ k+Rt+ q+ s+ qky
  Gorai.003G071500.2  97 PWTVEEHKLFLLGLQKVGKGNWRRISLYFVKTRTPTQVASHAQKY 141
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.46890146IPR017930Myb domain
SuperFamilySSF466897.48E-1792147IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-1593145IPR006447Myb domain, plants
SMARTSM007173.3E-994144IPR001005SANT/Myb domain
CDDcd001671.60E-997142No hitNo description
PfamPF002498.1E-1297141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1097140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MLPAMCSSAS SSVGNSIANC GERGEIMLFG VRLVVDSIRK IVSMNNLSQY EQPRESNNNN  60
KIGDKYKGDE YVTADYASAD DVIPHSTKNR ERKRGIPWTV EEHKLFLLGL QKVGKGNWRR  120
ISLYFVKTRT PTQVASHAQK YFLRQSNINR RRRRRSSLFD MTLDMSPRVR R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149154RRRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470311.11e-121PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B04e-47MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0D2QGT61e-126A0A0D2QGT6_G
STRINGVIT_17s0000g07510.t013e-50(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.21e-47MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]